PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000131126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 394aa    MW: 46051.5 Da    PI: 8.3316
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000131126genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.41.6e-54281581129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrF+Ptdeelv++yL+kk+++k +++ +vi++vd+yk+ePwdL+   k+ + +++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk+++
  MDP0000131126  28 VPPGFRFRPTDEELVDYYLRKKIASKLIDF-DVIRDVDLYKIEPWDLEDlcKIGSgDQNEWYFFSHKDKKYPTGSRTNRATKAGFWKATGRDKAIY 122
                    69***************************9.9***************943466553556************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + ++ lvg++ktLvfykgrap+g+k+dW+mheyrle
  MDP0000131126 123 RGEKFLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 158
                    *99999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-5720195IPR003441NAC domain
PROSITE profilePS5100557.47828195IPR003441NAC domain
PfamPF023652.3E-2829157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MAYSIVRINK VFHHYPQVKN MNTLSSHVPP GFRFRPTDEE LVDYYLRKKI ASKLIDFDVI  60
RDVDLYKIEP WDLEDLCKIG SGDQNEWYFF SHKDKKYPTG SRTNRATKAG FWKATGRDKA  120
IYRGEKFLVG MRKTLVFYKG RAPNGQKSDW IMHEYRLETR ENGTPQAKFK QDNQVLVCCR  180
SYHEEGWAVC RVFKKKLAAV SRMGDYVSPD CYDQVSFLPQ LDNPPRTSMS RTYASQNEQQ  240
LHYSQCKKEF DLQYNMPHHH HDSFLQLPQL ESPKSSTLTQ EEQFAQYISQ QNMFKSSSSP  300
SVHALDNNND YLEAVDQVKD WRALDKYVAS QLSHDQQDAS KKVTNYSHAE EIFHVAEHIN  360
MLANDASRRR DNNNNIGQDY ASTSTSTFQI DLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-442719614169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008354411.10.0PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-118NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM5WRV61e-177M5WRV6_PRUPE; Uncharacterized protein
STRINGVIT_02s0154g00020.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-119NAC 007